PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G143400.1
Common NamePHAVU_004G143400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 473aa    MW: 51832.6 Da    PI: 5.1995
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G143400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-175397147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT+eE++++++a k++G g W+ I +++g ++t+ q++s+ qk+
  Phvul.004G143400.1 53 REKWTEEEHQKFLEALKLYGRG-WRQIEEHIG-TKTAVQIRSHAQKF 97
                        789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.89E-1647101IPR009057Homeodomain-like
PROSITE profilePS5129421.20148102IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-1050104IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-1651100IPR006447Myb domain, plants
SMARTSM007174.5E-1352100IPR001005SANT/Myb domain
PfamPF002491.2E-145396IPR001005SANT/Myb domain
CDDcd001672.64E-115598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MEMQDQIEST RSTISGSASY CHSNGGKQSE TVASVGNSHT PKVRKPYTIT KQREKWTEEE  60
HQKFLEALKL YGRGWRQIEE HIGTKTAVQI RSHAQKFFSK VVRESEGSAE SSVQPINIPP  120
PRPKRKPLHP YPRKSLDAFK GHTTPNETET SQSTNLLVAE KDTPSPTSVL STVGSEAFGS  180
AFSEQNNRCL SPNSCTTDIH SVSLSPVEKE NDCMTSKASE EEEKGSPASV PLSIVSNPNV  240
CMKPEFSSKE TEYVIEDSTN MPQTTSIKLF GRTVSMIDNQ KLQNIDDNGK AITVKSDEVD  300
DVENEKPGQS TEQVDTQLSL GLVGGNCPIT PDSEGADRRD EPPKENMCLS ECAPDASFPQ  360
WSLYQGLPAF CVTPCNQILN PMPLRPSLKV RAREEESCCT GSNTESVCDI DNQGKNSDAV  420
DSKCQKYQGE GAAPQKPAKG FVPYKRCLAE REGNSLIAAM EERDGQRARV CS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152597.10.0hypothetical protein PHAVU_004G143400g
TrEMBLV7C6Q70.0V7C6Q7_PHAVU; Uncharacterized protein
STRINGGLYMA16G34340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.17e-54MYB_related family protein